
NBP1-55038 UBE4A antibody

See related secondary antibodies

Search for all "UBE4A"

Quick Overview

Rabbit anti Human, Mouse, Rat UBE4A

Product Description for UBE4A

Rabbit anti Human, Mouse, Rat UBE4A.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for UBE4A

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to UBE4A(ubiquitination factor E4A (UFD2 homolog, yeast)) The peptide sequence was selected from the middle region of UBE4A. Peptide sequence QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYR.
Background The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4A is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 9354

Accessory Products

  • LinkedIn