discontinued

H00007342-D01P UBP1 / LBP1 antibody

See related secondary antibodies

Search for all "UBP1 / LBP1"

Quick Overview

Rabbit anti Human UBP1 / LBP1

Product Description for UBP1 / LBP1

Rabbit anti Human UBP1 / LBP1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for UBP1 / LBP1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms LBP-1, Upstream-binding protein 1
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZI7
Immunogen:
UBP1 (NP_055332.2, 1 a.a. ~ 540 a.a) full-length human protein.
AA Sequence:
MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQEDSSLPLDGETEHPPFQYVMCAATSPAV KLHDETLTYLNQGQSYEIRMLDNRKMGDMPEINGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIP MSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQVDAFKQNENGEYTDHLHSA SCQIKVFKPKGADRKQKTDREKMEKRTAHEKEKYQPSYDTTILTEMRLEPIIEDAVEHEQKKSSKRTLPADYGDSL AKRGSCSPWPDAPTAYVNNSPSPAPTFTSPQQSTCSVPDSNSSSPNHQGDGASQTSGEQIQPSATIQETQQWLLKN RFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNSLKSRSVRPRLTIYVCREQPSSTVLQGQQQAASSASE NGSGAPYVYHAIYLEEMIASEVARKLALVFNIPLHQINQVYRQGPTGIHILVSDQMVQNFQDESCFLFSTVKAESS DGIHIILK
GeneID:
7342
Remarks:
Gene Accession: NM_014517.2
Add. information Rabbit polyclonal antibody raised against a full-length human UBP1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7342

Accessory Products

Proteins and/or Positive Controls

Proteins for UBP1 / LBP1 (3 products)

Catalog No. Species Pres. Purity   Source  

UBP1 / LBP1 (full length, N-term HIS tag, transcript variant 3)

UBP1 / LBP1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

UBP1 / LBP1

UBP1 / LBP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UBP1 / LBP1

UBP1 / LBP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UBP1 / LBP1 (2 products)

Catalog No. Species Pres. Purity   Source  

UBP1 293T Cell Transient Overexpression Lysate(Denatured)

UBP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

UBP1 Lysate

Western Blot: UBP1 Lysate [NBL1-17561] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UBP1
  Novus Biologicals Inc.
  • LinkedIn