NBP1-59598 UCP5 antibody

See related secondary antibodies

Search for all "UCP5"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Drosophila, Human, Mouse, Rat, Xenopus, Zebrafish UCP5

Product Description for UCP5

Rabbit anti Bovine, Canine, Chicken, Drosophila, Human, Mouse, Rat, Xenopus, Zebrafish UCP5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UCP5

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Bov, Can, Chk, Dros, Hu, Ms, Rt, Xen, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JY88
Immunogen:
Synthetic peptides corresponding to SLC25A14(solute carrier family 25 (mitochondrial carrier, brain), member 14) The peptide sequence was selected from the N terminal of SLC25A14. Peptide sequence SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALF
Background Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-terminal hydrophobic domain that is not present in other UCPs.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified

Accessory Products

  • LinkedIn