
NBP1-55444 UEVLD antibody

See related secondary antibodies

Search for all "UEVLD"

Quick Overview

Rabbit anti Human UEVLD


Product Description for UEVLD

Rabbit anti Human UEVLD.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for UEVLD

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ATTP, FLJ11068, UEV3
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to UEVLD(UEV and lactate/malate dehyrogenase domains) The peptide sequence was selected from the middle region of UEVLD. Peptide sequence SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGE.
Background UEVLD is a possible negative regulator of polyubiquitination.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn