NBP1-56538 UEVLD antibody

See related secondary antibodies

Search for all "UEVLD"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human UEVLD


Product Description for UEVLD

Rabbit anti Human UEVLD.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for UEVLD

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ATTP, FLJ11068, UEV3
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to UEVLD(UEV and lactate/malate dehyrogenase domains) The peptide sequence was selected from the N terminal of UEVLD. Peptide sequence FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP.
Background UEVLD is a possible negative regulator of polyubiquitination.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn