TA342611 UFD1L antibody

Rabbit Polyclonal Anti-UFD1L Antibody

See related secondary antibodies

Search for all "UFD1L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish UFD1L

Product Description for UFD1L

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish UFD1L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UFD1L

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms UB fusion protein 1, Ubiquitin fusion degradation protein 1 homolog
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92890
Immunogen:
The immunogen for anti-UFD1L antibody: synthetic peptide directed towards the middle region of human UFD1L. Synthetic peptide located within the following region: NYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERQVQHEEST.
GeneID:
7353
Application WB
Background The protein encoded by this gene forms a complex with two other proteins, nuclear protein localization-4 and valosin-containing protein, and this complex is necessary for the degradation of ubiquitited proteins. In addition, this complex controls the disassembly of the mitotic spindle and the formation of a closed nuclear envelope after mitosis. Mutations in this gene have been associated with Catch 22 syndrome as well as cardiac and craniofacial defects. Altertive splicing results in multiple transcript variants encoding different isoforms. A related pseudogene has been identified on chromosome 18.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 368% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UFD1L (8 products)

Catalog No. Species Pres. Purity   Source  

UFD1L (transcript variant 1)

UFD1L Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

UFD1L (transcript variant 2)

UFD1L Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

UFD1L (1-307, His-tag)

UFD1L Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

UFD1L (1-307, His-tag)

UFD1L Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

UFD1L

UFD1L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UFD1L

UFD1L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UFD1L

UFD1L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UFD1L

UFD1L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for UFD1L (3 products)

Catalog No. Species Pres. Purity   Source  

UFD1L Lysate

Western Blot: UFD1L Lysate [NBL1-17587] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UFD1L
  Novus Biologicals Inc.

UFD1L Lysate

Western Blot: UFD1L Lysate [NBL1-17588] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UFD1L
  Novus Biologicals Inc.

UFD1L overexpression lysate

UFD1L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn