TA341883 UGT1A4 antibody

Rabbit Polyclonal Anti-UGT1A4 Antibody

See related secondary antibodies

Search for all "UGT1A4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human UGT1A4

Product Description for UGT1A4

Rabbit anti Human UGT1A4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UGT1A4

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Bilirubin-specific UDPGT isozyme 2, GNT1, HUG-BR2, UDP-glucuronosyltransferase 1-4, UDP-glucuronosyltransferase 1A4, UDPGT, UGT-1D, UGT1, UGT1-04, UGT1.4, UGT1D
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P22310
Immunogen:
The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK.
GeneID:
54657
Application WB
Background This gene encodes a UDP-glucuronosyltransferase, an enzyme ofThe glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites.This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases.The locus includes thirteen unique alterte first exons followed by four common exons. Four ofThe alterte first exons are considered pseudogenes. Each ofThe remaining nine 5' exons may be spliced toThe four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodesThe substrate binding site, and is regulated by its own promoter.This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UGT1A4 (3 products)

Catalog No. Species Pres. Purity   Source  

UGT1A4

UGT1A4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

UGT1A4

UGT1A4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UGT1A4

UGT1A4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UGT1A4 (1 products)

Catalog No. Species Pres. Purity   Source  

UGT1A4 overexpression lysate

UGT1A4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn