discontinued

H00025989-B01P Unc-51-like kinase 3 (ULK3) antibody

See related secondary antibodies

Search for all "Unc-51-like kinase 3 (ULK3)"

Quick Overview

Mouse anti Human Unc-51-like kinase 3 (ULK3)

Product Description for Unc-51-like kinase 3 (ULK3)

Mouse anti Human Unc-51-like kinase 3 (ULK3).
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Unc-51-like kinase 3 (ULK3)

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Serine/threonine-protein kinase ULK3
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PHR2
Immunogen:
ULK3 (AAH56423, 1 a.a. ~ 215 a.a) full-length human protein.
AA Sequence:
MAGPGWGPPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLLTEIEILKGIRHPHIVQ LKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKPQNILLSSLEKPH LKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCQRQYDARVDLWSMGVILYGETSFPCFSP*
GeneID:
25989
Remarks:
Gene Accession: BC056423
Add. information Mouse polyclonal antibody raised against a full-length human ULK3 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 25989

Accessory Products

Proteins and/or Positive Controls

Proteins for Unc-51-like kinase 3 (ULK3) (6 products)

Catalog No. Species Pres. Purity   Source  

Unc-51-like kinase 3 (ULK3)

Unc-51-like kinase 3 (ULK3) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Unc-51-like kinase 3 (ULK3)

Unc-51-like kinase 3 (ULK3) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Unc-51-like kinase 3 (ULK3)

Unc-51-like kinase 3 (ULK3) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Unc-51-like kinase 3 (ULK3)

Unc-51-like kinase 3 (ULK3) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Unc-51-like kinase 3 (ULK3)

Unc-51-like kinase 3 (ULK3) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Unc-51-like kinase 3 (ULK3)

Unc-51-like kinase 3 (ULK3) Human
  Abnova Taiwan Corp.

Positive controls for Unc-51-like kinase 3 (ULK3) (1 products)

Catalog No. Species Pres. Purity   Source  

ULK3 293T Cell Transient Overexpression Lysate(Denatured)

ULK3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn