discontinued

NBP1-54882 UNC45A antibody

See related secondary antibodies

Search for all "UNC45A"

50 µg / €440.00

Quick Overview

Rabbit anti Human UNC45A

Product Description for UNC45A

Rabbit anti Human UNC45A.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for UNC45A

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ10043, GC-UNC45, IRO039700, SMAP-1
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8K6F7
Immunogen:
Synthetic peptides corresponding to UNC45A(unc-45 homolog A (C. elegans)) The peptide sequence was selected from the middle region of UNC45A. Peptide sequence REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG.
GeneID:
55898
Background UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor (PGR; MIM 607311) and HSP90 (HSPCA; MIM 140571), and acts as a regulator of the progesterone receptor chaperoning pathway.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 55898

Accessory Products

  • LinkedIn