NBP1-69282 UNC5C antibody

See related secondary antibodies

Search for all "UNC5C"

50 µg / €390.00

Quick Overview

Rabbit anti Human UNC5C

Product Description for UNC5C

Rabbit anti Human UNC5C.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for UNC5C

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to UNC5C(unc-5 homolog C (C. elegans)) The peptide sequence was selected from the middle region of UNC5C. Peptide sequence VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS.
Background UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 22253

Accessory Products

  • LinkedIn