discontinued

H00222643-B01 UNC5CL antibody

See related secondary antibodies

Search for all "UNC5CL"

Quick Overview

Mouse anti Human UNC5CL

Product Description for UNC5CL

Mouse anti Human UNC5CL.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for UNC5CL

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Protein unc-5 homolog C-like, UNC5C-like protein, ZU5 and death domain-containing protein, ZUD
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IV45
Immunogen:
UNC5CL (NP_775832.1, 1 a.a. ~ 518 a.a) full-length human protein.
AA Sequence:
MCPQESSFQPSQFLLLVGVPVASVLLLAQCLRWHCPRRLLGACWTLNGQEEPVSQPTPQLENEVSRQHLPATLPEM VAFYQELHTPTQGQTMVRQLMHKLLVFSAREVDHRGGCLMLQDTGISLLIPPGAVAVGRQERVSLILVWDLSDAPS LSQAQGLVSPVVACGPHGASFLKPCTLTFKHCAEQPSHARTYSSNTTLLDAKVWRPLGRPGAHASRDECRIHLSHF SLYTCVLEAPVGREARKWLQLAVFCSPLVPGQSHLQLRIYFLNNTPCALQWALTNEQPHGGRLRGPCQLFDFNGAR GDQCLKLTYISEGWENVDDSSCQLVPHLHIWHGKCPFRSFCFRRKAADENEDCSALTNEIIVTMHTFQDGLETKYM EILRFQASEEESWAAPPPVSQPPPCNRLPPELFEQLRMLLEPNSITGNDWRGLASHLGLCGMKIRFLSCQRSPAAA ILELFEEQNGSLQELHYLMTVMERLDCASAIQNYLSGTHGGSPGPERGGARDNQGLELDEKL
GeneID:
222643
Remarks:
Gene Accession: NM_173561.1
Add. information Mouse polyclonal antibody raised against a full-length human UNC5CL protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 222643

Accessory Products

Proteins and/or Positive Controls

Proteins for UNC5CL (4 products)

Catalog No. Species Pres. Purity   Source  

UNC5CL

UNC5CL Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

UNC5CL

UNC5CL Human in vitro transl.
  Abnova Taiwan Corp.

UNC5CL

UNC5CL Human in vitro transl.
  Abnova Taiwan Corp.

UNC5CL

UNC5CL Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for UNC5CL (1 products)

Catalog No. Species Pres. Purity   Source  

UNC5CL 293T Cell Transient Overexpression Lysate(Denatured)

UNC5CL 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn