discontinued

H00023353-B02 UNC84A antibody

See related secondary antibodies

Search for all "UNC84A"

Quick Overview

Mouse anti Human UNC84A

Product Description for UNC84A

Mouse anti Human UNC84A.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for UNC84A

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms KIAA0810, Protein unc-84 homolog A, SUN1, Sad1/unc-84 protein-like 1
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O94901
Immunogen:
UNC84A (AAH13613, 1 a.a. ~ 257 a.a) full-length human protein.
AA Sequence:
MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSG TSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGL DDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAPPGPVSRVYSRDRNQKCKSQSFKTQ KKVCFPNLIFPFCKSQCLHYLSWRLKIIP
GeneID:
23353
Remarks:
Gene Accession: BC013613
Add. information Mouse polyclonal antibody raised against a full-length human UNC84A protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 23353

Accessory Products

Proteins and/or Positive Controls

Proteins for UNC84A (6 products)

Catalog No. Species Pres. Purity   Source  

UNC84A

UNC84A Human
  Abnova Taiwan Corp.

UNC84A

UNC84A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UNC84A

UNC84A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UNC84A

UNC84A Human Purified
  Abnova Taiwan Corp.

UNC84A

UNC84A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UNC84A

UNC84A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for UNC84A (4 products)

Catalog No. Species Pres. Purity   Source  

SUN1 overexpression lysate

SUN1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

SUN1 overexpression lysate

SUN1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

UNC84A 293T Cell Transient Overexpression Lysate(Denatured)

UNC84A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

UNC84A 293T Cell Transient Overexpression Lysate(Denatured)

UNC84A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn