TA339546 UNC84A antibody

Rabbit Polyclonal Anti-SUN1 Antibody

See related secondary antibodies

Search for all "UNC84A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat UNC84A

TA339546

More Views

  • TA339546
  • TA339546

Product Description for UNC84A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat UNC84A.
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for UNC84A

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms KIAA0810, Protein unc-84 homolog A, SUN1, Sad1/unc-84 protein-like 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications ICC/IF, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O94901
Immunogen:
The immunogen for anti-UNC84A antibody: synthetic peptide directed towards the N terminal of human UNC84A. Synthetic peptide located within the following region: QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA.
GeneID:
23353
Application WB
IF
Background UNC84A is a a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration.This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several altertively spliced transcript variants of this gene have been described; however, the full-length ture of some of these variants has not been determined.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UNC84A (6 products)

Catalog No. Species Pres. Purity   Source  

UNC84A

UNC84A Human
  Abnova Taiwan Corp.

UNC84A

UNC84A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UNC84A

UNC84A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UNC84A

UNC84A Human Purified
  Abnova Taiwan Corp.

UNC84A

UNC84A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UNC84A

UNC84A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for UNC84A (4 products)

Catalog No. Species Pres. Purity   Source  

SUN1 overexpression lysate

SUN1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

SUN1 overexpression lysate

SUN1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

UNC84A 293T Cell Transient Overexpression Lysate(Denatured)

UNC84A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

UNC84A 293T Cell Transient Overexpression Lysate(Denatured)

UNC84A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn