TA342415 UNCX antibody

Rabbit Polyclonal Anti-UNCX Antibody

See related secondary antibodies

Search for all "UNCX"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat UNCX

Product Description for UNCX

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat UNCX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UNCX

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Homeobox protein unc-4 homolog, UNCX4.1
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NJT0
Immunogen:
The immunogen for anti-UNCX antibody: synthetic peptide directed towards the N terminal of human UNCX. Synthetic peptide located within the following region: LLPAACGVGGDGQPFKLSDSGDPDKESPGCKRRRTRTNFTGWQLEELEKA.
GeneID:
340260
Application WB
Background Transcription factor involved in somitogenesis and neurogenesis. Required for the maintence and differentiation of particular elements of the axial skeleton. May act upstream of PAX9. Plays a role in controlling the development of connections of hypothalamic neurons to pituitary elements, allowing central neurons to reach the peripheral blood circulation and to deliver hormones for control of peripheral functions.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 162% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for UNCX (1 products)

Catalog No. Species Pres. Purity   Source  

UNCX overexpression lysate

UNCX overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn