discontinued

H00065110-B01P UPF3A / RENT3A antibody

See related secondary antibodies

Search for all "UPF3A / RENT3A"

Quick Overview

Mouse anti Human UPF3A / RENT3A

H00065110-B01P

More Views

  • H00065110-B01P

Product Description for UPF3A / RENT3A

Mouse anti Human UPF3A / RENT3A.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for UPF3A / RENT3A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Nonsense mRNA reducing factor 3A, Regulator of nonsense transcripts 3A, UPF3, Up-frameshift suppressor 3 homolog A
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H1J1
Immunogen:
UPF3A (NP_542418.1, 1 a.a. ~ 443 a.a) full-length human protein.
AA Sequence:
MRSEKEGAGGLRAAVAARGPSGREKLSALEVQFHRDSQQQEAETPPTSSSGCGGGAGKPREEKRTALSKVVIRRLP PGLTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINFRNPDDILLFRDRFDGYIFLDSKDPEYKKFLETYC VEEEKTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLEKQRIREEKREERRRRELEKKRLREEEKRRRREEE RCKKKETDKQKKIAEKEVRIKLLKKPEKGEEPTTEKPKERGEEIDTGGGKQESCAPGAVVKARPMEGSLEEPQETS HSGSDKEHRDVERSQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPGEAMER LGRAQRCDDSPAPRKERLANKDRPALQLYDPGARFRARECGGNRRICKAEGSGTGPEKREEAE
GeneID:
65110
Remarks:
Gene Accession: NM_080687.1
Add. information Mouse polyclonal antibody raised against a full-length human UPF3A protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 65110

Accessory Products

Proteins and/or Positive Controls

Proteins for UPF3A / RENT3A (6 products)

Catalog No. Species Pres. Purity   Source  

UPF3A / RENT3A (transcript variant 2)

UPF3A / RENT3A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

UPF3A / RENT3A

UPF3A / RENT3A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UPF3A / RENT3A

UPF3A / RENT3A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

UPF3A / RENT3A

UPF3A / RENT3A Human Purified
  Abnova Taiwan Corp.

UPF3A / RENT3A

UPF3A / RENT3A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UPF3A / RENT3A

UPF3A / RENT3A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for UPF3A / RENT3A (3 products)

Catalog No. Species Pres. Purity   Source  

UPF3A 293T Cell Transient Overexpression Lysate(Denatured)

UPF3A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

UPF3A overexpression lysate

UPF3A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

UPF3A overexpression lysate

UPF3A overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn