discontinued

H00007374-B01P Uracil-DNA glycosylase (UNG) antibody

See related secondary antibodies

Search for all "Uracil-DNA glycosylase (UNG)"

Quick Overview

Mouse anti Human Uracil-DNA glycosylase (UNG)

H00007374-B01P

More Views

  • H00007374-B01P
  • H00007374-B01P

Product Description for Uracil-DNA glycosylase (UNG)

Mouse anti Human Uracil-DNA glycosylase (UNG).
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for Uracil-DNA glycosylase (UNG)

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DGU, UDG, UNG1, UNG15
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P13051
Immunogen:
UNG (NP_003353.1, 1 a.a. ~ 304 a.a) full-length human protein.
AA Sequence:
MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRL AARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQ AHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDA VVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
GeneID:
7374
Remarks:
Gene Accession: NM_003362
Add. information Mouse polyclonal antibody raised against a full-length human UNG protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7374

Accessory Products

Proteins and/or Positive Controls

Proteins for Uracil-DNA glycosylase (UNG) (7 products)

Catalog No. Species Pres. Purity   Source  

Uracil-DNA glycosylase (UNG) (transcript variant 2)

Uracil-DNA glycosylase (UNG) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

Uracil-DNA glycosylase (UNG) (full length, N-term HIS tag)

Uracil-DNA glycosylase (UNG) Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Uracil-DNA glycosylase (UNG)

Uracil-DNA glycosylase (UNG) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Uracil-DNA glycosylase (UNG)

Uracil-DNA glycosylase (UNG) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Uracil-DNA glycosylase (UNG)

Uracil-DNA glycosylase (UNG) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Uracil-DNA glycosylase (UNG)

Uracil-DNA glycosylase (UNG) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Uracil-DNA glycosylase (UNG)

Uracil-DNA glycosylase (UNG) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Uracil-DNA glycosylase (UNG) (3 products)

Catalog No. Species Pres. Purity   Source  

UNG 293T Cell Transient Overexpression Lysate(Denatured)

UNG 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

uracil-DNA glycosylase Lysate

Western Blot: uracil-DNA glycosylase Lysate [NBL1-17620] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UNG
  Novus Biologicals Inc.

uracil-DNA glycosylase Lysate

Western Blot: uracil-DNA glycosylase Lysate [NBL1-17621] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UNG
  Novus Biologicals Inc.
  • LinkedIn