
NBP1-53113 URG4 antibody

See related secondary antibodies

Search for all "URG4"

50 µg / €390.00

Quick Overview

Rabbit anti Human URG4

Product Description for URG4

Rabbit anti Human URG4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for URG4

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to URG4(up-regulated gene 4) The peptide sequence was selected from the middle region of URG4. Peptide sequence AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR.
Background The specific function of this protein remains unknown.URG4 is upregulated in the presence of hepatitis B virus (HBV)-encoded X antigen (HBxAg) and may contribute to the development of hepatocellular carcinoma by promoting hepatocellular growth and survival (Tufan et al., 2002 [PubMed 12082552]).[supplied by OMIM].
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn