discontinued

H00010083-M04 USH1C / Harmonin antibody

See related secondary antibodies

Search for all "USH1C / Harmonin"

Quick Overview

Mouse anti Human USH1C / Harmonin 2B9

Product Description for USH1C / Harmonin

Mouse anti Human USH1C / Harmonin 2B9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for USH1C / Harmonin

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms AIE75, Antigen NY-CO-38/NY-CO-37, Autoimmune enteropathy-related antigen AIE-75, NY-REN-3, PDZ-73 protein, Renal carcinoma antigen NY-REN-3, Usher syndrome type-1C protein
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2B9
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y6N9
Immunogen:
USH1C (AAH16057, 424 a.a. ~ 534 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
FTPEQIMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEA DAALQKAWNQGGDWIDLVVAVCPPKEYDDELTFF*
GeneID:
10083
Remarks:
Gene Accession: BC016057
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant USH1C.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10083

Accessory Products

Proteins and/or Positive Controls

Proteins for USH1C / Harmonin (6 products)

Catalog No. Species Pres. Purity   Source  

USH1C / Harmonin (1-533, His-tag)

USH1C  / Harmonin Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €750.00
  Acris Antibodies GmbH

USH1C / Harmonin (1-533, His-tag)

USH1C  / Harmonin Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

USH1C / Harmonin

USH1C  / Harmonin Human Purified
  Abnova Taiwan Corp.

USH1C / Harmonin

USH1C  / Harmonin Human Purified
  Abnova Taiwan Corp.

USH1C / Harmonin

USH1C  / Harmonin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

USH1C / Harmonin

USH1C  / Harmonin Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for USH1C / Harmonin (2 products)

Catalog No. Species Pres. Purity   Source  

USH1C 293T Cell Transient Overexpression Lysate(Denatured)

USH1C 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

USH1C overexpression lysate

USH1C overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn