
NBP1-69151 USP47 antibody

See related secondary antibodies

Search for all "USP47"

50 µg / €390.00

Quick Overview

Rabbit anti Human USP47


Product Description for USP47

Rabbit anti Human USP47.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for USP47

Product Category Primary Antibodies
Quantity 50 µg
Synonyms TRFP
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to USP47 (ubiquitin specific peptidase 47) The peptide sequence was selected from the middle region of USP47. Peptide sequence SITSSRRTKANEGKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEP.
Background USP47 is a putative ubiquitin-specific-processing protease that regulates cell growth and survival. USP47 probably regulates CDC25A expression at a transcriptional level. USP47 may be catalytically inactive although it seems to have kept all necessary active site residues.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn