discontinued

H00084196-M01 USP48 antibody

See related secondary antibodies

Search for all "USP48"

Quick Overview

Mouse anti Human USP48 3G4

H00084196-M01

More Views

  • H00084196-M01
  • H00084196-M01

Product Description for USP48

Mouse anti Human USP48 3G4.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for USP48

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Deubiquitinating enzyme 48, USP31, Ubiquitin carboxyl-terminal hydrolase 48, Ubiquitin thioesterase 48, Ubiquitin-specific-processing protease 48
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 3G4
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UV5
Immunogen:
USP48 (NP_115612, 110 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
NLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEF SKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAY*
GeneID:
84196
Remarks:
Gene Accession: NM_032236
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant USP48.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 84196

Accessory Products

Proteins and/or Positive Controls

Proteins for USP48 (4 products)

Catalog No. Species Pres. Purity   Source  

USP48

USP48 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

USP48

USP48 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

USP48

USP48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

USP48

USP48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for USP48 (1 products)

Catalog No. Species Pres. Purity   Source  

USP48 293T Cell Transient Overexpression Lysate(Denatured)

USP48 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn