TA336029 USP48 antibody

Rabbit Polyclonal Anti-USP48 Antibody

See related secondary antibodies

Search for all "USP48"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat USP48

Product Description for USP48

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat USP48.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for USP48

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Deubiquitinating enzyme 48, USP31, Ubiquitin carboxyl-terminal hydrolase 48, Ubiquitin thioesterase 48, Ubiquitin-specific-processing protease 48
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UV5
Immunogen:
The immunogen for Anti-USP48 Antibody: synthetic peptide directed towards the middle region of human USP48. Synthetic peptide located within the following region: ALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYV.
GeneID:
84196
Application WB
Background USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-termil hydrolases. Family members function as deubiquititing enzymes, recognizing and hydrolyzing the peptide bond at the C-termil glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitited proteins.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for USP48 (4 products)

Catalog No. Species Pres. Purity   Source  

USP48

USP48 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

USP48

USP48 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

USP48

USP48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

USP48

USP48 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for USP48 (1 products)

Catalog No. Species Pres. Purity   Source  

USP48 293T Cell Transient Overexpression Lysate(Denatured)

USP48 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn