TA330817 UTP11L antibody

Rabbit Polyclonal Anti-UTP11L Antibody

See related secondary antibodies

Search for all "UTP11L"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Yeast, Zebrafish UTP11L

Product Description for UTP11L

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Yeast, Zebrafish UTP11L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UTP11L

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CGI-94, HDCMB12P, Probable U3 small nucleolar RNA-associated protein 11
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-UTP11L antibody is: synthetic peptide directed towards the N-terminal region of Human UTP11L. Synthetic peptide located within the following region: AKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKA.
Application WB
Background UTP11L is involved in nucleolar processing of pre-18S ribosomal R.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for UTP11L (3 products)

Catalog No. Species Pres. Purity   Source  

UTP11L (full length, N-term HIS tag)

UTP11L Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.


UTP11L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


UTP11L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for UTP11L (3 products)

Catalog No. Species Pres. Purity   Source  

UTP11L 293T Cell Transient Overexpression Lysate(Denatured)

UTP11L 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

UTP11L Lysate

Western Blot: UTP11L Lysate [NBL1-17676] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for UTP11L.
  Novus Biologicals Inc.

UTP11L overexpression lysate

UTP11L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn