discontinued

H00055350-A01 Vanin-3 antibody

See related secondary antibodies

Search for all "Vanin-3"

Quick Overview

Mouse anti Human Vanin-3

Product Description for Vanin-3

Mouse anti Human Vanin-3.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Vanin-3

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms VNN3, Vascular non-inflammatory molecule 3
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NY84
Immunogen:
VNN3 (NP_060869, 175 a.a. ~ 275 a.a) partial recombinant protein with GST tag.
AA Sequence:
ARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFP SIQHGPRPWESIYLLQIPTTPACT*
GeneID:
55350
Remarks:
Gene Accession: NM_018399
Add. information Mouse polyclonal antibody raised against a partial recombinant VNN3.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 55350

Accessory Products

Proteins and/or Positive Controls

Proteins for Vanin-3 (2 products)

Catalog No. Species Pres. Purity   Source  

Vanin-3

Vanin-3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Vanin-3

Vanin-3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Vanin-3 (2 products)

Catalog No. Species Pres. Purity   Source  

VNN3 293T Cell Transient Overexpression Lysate(Denatured)

VNN3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

VNN3 Lysate

Western Blot: VNN3 Lysate [NBL1-17733] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for VNN3
  Novus Biologicals Inc.
  • LinkedIn