H00079805-B01P VASH2 antibody

See related secondary antibodies

Search for all "VASH2"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human VASH2

H00079805-B01P

Product Description for VASH2

Mouse anti Human VASH2.
Product is tested for Western blot / Immunoblot.

Properties for VASH2

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ12505, RP11-275G3.1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86V25
Immunogen:
VASH2 (NP_079025.2, 1 a.a. ~ 311 a.a) full-length human protein.
AA Sequence:
MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPK GGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLHYLTNGQPSIERFPISFKTYFSGNYFHHVVL GIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVS KMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNE VGYQIRI
GeneID:
79805
Add. information Mouse polyclonal antibody raised against a full-length human VASH2 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for VASH2 (1 products)

Catalog No. Species Pres. Purity   Source  

Vasohibin 2 (VASH2), transcript variant 1 (transcript variant 1)

Vasohibin 2 (VASH2), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for VASH2 (1 products)

Catalog No. Species Pres. Purity   Source  

VASH2 Lysate

Western Blot: VASH2 Lysate [NBL1-17698] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for VASH2
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn