TA338558 VDAC-3 antibody

Rabbit Polyclonal Anti-VDAC3 Antibody

See related secondary antibodies

Search for all "VDAC-3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish VDAC-3

TA338558

More Views

  • TA338558
  • TA338558
  • TA338558
  • TA338558

Product Description for VDAC-3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish VDAC-3.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for VDAC-3

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Outer mitochondrial membrane protein porin 3, VDAC3, Voltage-dependent anion-selective channel protein 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y277
Immunogen:
The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF.
GeneID:
7419
Application WB
IHC
Background This gene encodes a voltage-dependent anion channel (VDAC), and belongs to the mitochondrial porin family. VDACs are small, integral membrane proteins that traverse the outer mitochondrial membrane and conduct ATP and other small metabolites. They are known to bind several kises of intermediary metabolism, thought to be involved in translocation of adenine nucleotides, and are hypothesized to form part of the mitochondrial permeability transition pore, which results in the release of cytochrome c at the onset of apoptotic cell death. Altertively transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for VDAC-3 (2 products)

Catalog No. Species Pres. Purity   Source  

VDAC-3

VDAC-3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

VDAC-3

VDAC-3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for VDAC-3 (2 products)

Catalog No. Species Pres. Purity   Source  

VDAC3 Lysate

Western Blot: VDAC3 Lysate [NBL1-17710] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for VDAC3.
  Novus Biologicals Inc.

VDAC3 overexpression lysate

VDAC3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn