discontinued

H00002324-M01 VEGFR-3 / Flt-4 antibody

See related secondary antibodies

Search for all "VEGFR-3 / Flt-4"

Quick Overview

Mouse anti Human VEGFR-3 / Flt-4 5B6

Product Description for VEGFR-3 / Flt-4

Mouse anti Human VEGFR-3 / Flt-4 5B6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for VEGFR-3 / Flt-4

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms FLT4, Tyrosine-protein kinase receptor FLT4, VEGF Receptor 3, VEGFR3, Vascular endothelial growth factor receptor 3
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 5B6
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P35917
Immunogen:
FLT4 (NP_002011, 34 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSY VCYYKYIKARIEGTTAASSYVFVR
GeneID:
14257
Remarks:
Gene Accession: NM_002020
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant FLT4.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 2324

Accessory Products

  • LinkedIn