discontinued

H00007429-B01 Villin-1 antibody

See related secondary antibodies

Search for all "Villin-1"

Quick Overview

Mouse anti Human Villin-1

H00007429-B01

More Views

  • H00007429-B01

Product Description for Villin-1

Mouse anti Human Villin-1.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Villin-1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms VIL1
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P09327
Immunogen:
VIL1 (AAH17303.1, 1 a.a. ~ 421 a.a) full-length human protein.
AA Sequence:
MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQG AAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLLHVKGKRNVVAGE VEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNH VLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKAN EQEKKGAMSHALNFIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWTASNRTSGLGKTHTVGSVGEGQAGAVREPGS RSWARRATWSTTHPPSLTCIFNEDFYAGSGLVLADGDVDKL
GeneID:
7429
Remarks:
Gene Accession: BC017303.2
Add. information Mouse polyclonal antibody raised against a full-length human VIL1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 7429

Accessory Products

Proteins and/or Positive Controls

Proteins for Villin-1 (8 products)

Catalog No. Species Pres. Purity   Source  

Villin-1

Villin-1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Villin-1

Villin-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Villin-1

Villin-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Villin-1

Villin-1 Human Purified
  Abnova Taiwan Corp.

Villin-1

Villin-1 Human
  Abnova Taiwan Corp.

Villin-1

Villin-1 Human Purified
  Abnova Taiwan Corp.

Villin-1

Villin-1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Villin-1

Villin-1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn