discontinued

H00007414-M02 Vinculin (VCL) antibody

See related secondary antibodies

Search for all "Vinculin (VCL)"

Quick Overview

Mouse anti Human Vinculin (VCL) 3F8-1D4

Product Description for Vinculin (VCL)

Mouse anti Human Vinculin (VCL) 3F8-1D4.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for Vinculin (VCL)

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Metavinculin
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3F8-1D4
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P18206
Immunogen:
VCL (AAH39174, 1 a.a. ~ 1067 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPP AFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVE TMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALK NRNFTLEKMSAEINEIIRVLQLTSWDE
GeneID:
7414
Remarks:
Gene Accession: BC039174
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a full-length recombinant VCL.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7414

Accessory Products

Proteins and/or Positive Controls

Proteins for Vinculin (VCL) (3 products)

Catalog No. Species Pres. Purity   Source  

Vinculin (VCL) (transcript variant 2)

Vinculin (VCL) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Vinculin (VCL)

Vinculin (VCL) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Vinculin (VCL)

Vinculin (VCL) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Vinculin (VCL) (1 products)

Catalog No. Species Pres. Purity   Source  

Vinculin Lysate

Western Blot: Vinculin Lysate [NBL1-17706] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for VCL
  Novus Biologicals Inc.
  • LinkedIn