TA343106 Vinculin (VCL) antibody

Rabbit Polyclonal Anti-VCL Antibody

See related secondary antibodies

Search for all "Vinculin (VCL)"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Vinculin (VCL)

Product Description for Vinculin (VCL)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Vinculin (VCL).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Vinculin (VCL)

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Metavinculin
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-VCL antibody: synthetic peptide directed towards the C terminal of human VCL. Synthetic peptide located within the following region: PRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKGNDIIAA.
Application WB
Background Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. Defects in VCL are the cause of cardiomyopathy dilated type 1W. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Multiple altertively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 865% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Vinculin (VCL) (3 products)

Catalog No. Species Pres. Purity   Source  

Vinculin (VCL) (transcript variant 2)

Vinculin (VCL) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Vinculin (VCL)

Vinculin (VCL) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Vinculin (VCL)

Vinculin (VCL) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Vinculin (VCL) (1 products)

Catalog No. Species Pres. Purity   Source  

Vinculin Lysate

Western Blot: Vinculin Lysate [NBL1-17706] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for VCL
  Novus Biologicals Inc.
  • LinkedIn