H00155382-B01P VPS37D antibody

See related secondary antibodies

Search for all "VPS37D"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human VPS37D

H00155382-B01P

Product Description for VPS37D

Mouse anti Human VPS37D.
Product is tested for Western blot / Immunoblot.

Properties for VPS37D

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC35352, WBSCR24
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86XT2
Immunogen:
VPS37D (AAI56355.1, 1 a.a. ~ 251 a.a) full-length human protein.
AA Sequence:
MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLALRPRLE MGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHCALGWLQAELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQ RGRALAHLRRTQAEKLQELLRRRERSAQPAPTSAADPPKSFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPPLKGS PGCPLGPAPLLSPRPSQPEPPHR
GeneID:
155382
Add. information Mouse polyclonal antibody raised against a full-length human VPS37D protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for VPS37D (1 products)

Catalog No. Species Pres. Purity   Source  

VPS37D overexpression lysate

VPS37D overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn