
NBP1-56539 VPS53 antibody

See related secondary antibodies

Search for all "VPS53"

Quick Overview

Rabbit anti Human VPS53


Product Description for VPS53

Rabbit anti Human VPS53.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for VPS53

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to VPS53(vacuolar protein sorting 53 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of VPS53. Peptide sequence VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK.
Background This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn