TA335555 VPS54 antibody

Rabbit Polyclonal Anti-VPS54 Antibody

See related secondary antibodies

Search for all "VPS54"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat VPS54

Product Description for VPS54

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat VPS54.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for VPS54

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms HCC8, HOM-HCC-8, SLP-8p, Vacuolar protein sorting-associated protein 54
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P1Q0
Immunogen:
The immunogen for Anti-VPS54 Antibody: synthetic peptide directed towards the N terminal of human VPS54. Synthetic peptide located within the following region: FNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVNIAHQISLRS.
GeneID:
51542
Application WB
Background VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi. This gene encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Altertive splicing results in multiple transcript variants encoding different isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for VPS54 (2 products)

Catalog No. Species Pres. Purity   Source  

VPS54

VPS54 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

VPS54

VPS54 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for VPS54 (2 products)

Catalog No. Species Pres. Purity   Source  

VPS54 293T Cell Transient Overexpression Lysate(Denatured)

VPS54 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

VPS54 overexpression lysate

VPS54 overexpression lysate
  OriGene Technologies, Inc.
  • LinkedIn