NBP1-55274 VPS8 antibody

See related secondary antibodies

Search for all "VPS8"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat VPS8

Product Description for VPS8

Rabbit anti Human, Mouse, Rat VPS8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for VPS8

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B9EIQ1
Immunogen:
Synthetic peptides corresponding to VPS8(vacuolar protein sorting 8 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS8. Peptide sequence CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDDPTLAICNDSG.
Background VPS8 belongs to the VPS8 family. It contains 1 RING-type zinc finger and 1 WD repeat. The functions of VPS8 remain unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn