
NBP1-55274 VPS8 antibody

See related secondary antibodies

Search for all "VPS8"

Quick Overview

Rabbit anti Human, Mouse, Rat VPS8

Product Description for VPS8

Rabbit anti Human, Mouse, Rat VPS8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for VPS8

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to VPS8(vacuolar protein sorting 8 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS8. Peptide sequence CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDDPTLAICNDSG.
Background VPS8 belongs to the VPS8 family. It contains 1 RING-type zinc finger and 1 WD repeat. The functions of VPS8 remain unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn