NBP1-93776 VWA3A antibody

See related secondary antibodies

Search for all "VWA3A"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human VWA3A

Product Description for VWA3A

Rabbit anti Human VWA3A.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for VWA3A

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NCI4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KCCDSFNLLSFAESLQSWQDTLVETTDAACHEAMQWVTHLQAQGSTSILQALLKAFSFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKRDVKVHTISLNCSDRAAVEFLRKLA
GeneID:
146177
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 146177

Accessory Products

Proteins and/or Positive Controls

Positive controls for VWA3A (1 products)

Catalog No. Species Pres. Purity   Source  

VWA3A overexpression lysate

VWA3A overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn