NBP1-93870 VWA5B1 antibody

See related secondary antibodies

Search for all "VWA5B1"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human VWA5B1

Product Description for VWA5B1

Rabbit anti Human VWA5B1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for VWA5B1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TIE3
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PQFCTKSTGTSNQQAQGKDRHCFGAWAPGSWNKLCLATLLNTEVSNPMEYEFNFQLEIRGPCLLAGEESPTHEIRAD
GeneID:
127731
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 127731

Accessory Products

Proteins and/or Positive Controls

Proteins for VWA5B1 (1 products)

Catalog No. Species Pres. Purity   Source  

Von Willebrand factor A domain containing 5B1 (VWA5B1)

Von Willebrand factor A domain containing 5B1 (VWA5B1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for VWA5B1 (1 products)

Catalog No. Species Pres. Purity   Source  

VWA5B1 overexpression lysate

VWA5B1 overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn