NBP1-94166 VWC2L antibody

See related secondary antibodies

Search for all "VWC2L"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human VWC2L

Product Description for VWC2L

Rabbit anti Human VWC2L.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for VWC2L

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B2RUY7
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: AAISHEDYPADEGDQISSNDNLIFDDYRGK
GeneID:
402117
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 402117

Accessory Products

Proteins and/or Positive Controls

Proteins for VWC2L (1 products)

Catalog No. Species Pres. Purity   Source  

Von Willebrand factor C domain-containing protein 2-like (VWC2L)

Von Willebrand factor C domain-containing protein 2-like (VWC2L) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for VWC2L (1 products)

Catalog No. Species Pres. Purity   Source  

VWC2L overexpression lysate

VWC2L overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn