discontinued

H00010785-B01 WDR4 antibody

See related secondary antibodies

Search for all "WDR4"

Quick Overview

Mouse anti Human WDR4

Product Description for WDR4

Mouse anti Human WDR4.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for WDR4

Product Category Primary Antibodies
Quantity 50 µl
Synonyms WD repeat-containing protein 4, tRNA (guanine-N(7)-)-methyltransferase subunit WDR4
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
WDR4
Immunogen:
WDR4 (NP_061139, 1 a.a. ~ 412 a.a) full-length human protein.
AA Sequence:
MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYF ALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVA VSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCH LASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLW VLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQ QQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC
GeneID:
10785
Remarks:
Gene Accession: NM_018669
Add. information Mouse polyclonal antibody raised against a full-length human WDR4 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10785

Accessory Products

  • LinkedIn