H00010785-B01 WDR4 antibody

See related secondary antibodies

Search for all "WDR4"

50 µl / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human WDR4

Product Description for WDR4

Mouse anti Human WDR4.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for WDR4

Product Category Primary Antibodies
Quantity 50 µl
Synonyms WD repeat-containing protein 4, tRNA (guanine-N(7)-)-methyltransferase subunit WDR4
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
WDR4
Immunogen:
WDR4 (NP_061139, 1 a.a. ~ 412 a.a) full-length human protein.
AA Sequence:
MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYF ALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVA VSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCH LASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLW VLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQ QQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC
GeneID:
10785
Remarks:
Gene Accession: NM_018669
Add. information Mouse polyclonal antibody raised against a full-length human WDR4 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 10785

Accessory Products

  • LinkedIn