TA337579 WDR49 antibody

Rabbit Polyclonal Anti-WDR49 Antibody

See related secondary antibodies

Search for all "WDR49"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Rat WDR49

Product Description for WDR49

Rabbit anti Bovine, Human, Rat WDR49.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WDR49

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms WD repeat-containing protein 49
Presentation Purified
Reactivity Bov, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IV35
Immunogen:
The immunogen for anti-WDR49 antibody: synthetic peptide directed towards the C terminal of human WDR49. Synthetic peptide located within the following region: ACSFPKSQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKA.
GeneID:
151790
Application WB
Background WDR49 contains 8 WD repeats. The exact function of WDR49 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for WDR49 (1 products)

Catalog No. Species Pres. Purity   Source  

WDR49 overexpression lysate

WDR49 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn