TA334091 WDR51A antibody

Rabbit Polyclonal Anti-Poc1a Antibody

See related secondary antibodies

Search for all "WDR51A"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat WDR51A

Product Description for WDR51A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat WDR51A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WDR51A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms WD repeat-containing protein 51A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-Poc1a Antibody is: synthetic peptide directed towards the C-terminal region of Rat Poc1a. Synthetic peptide located within the following region: SRTGEYFASGGSDEQVMVWKSNFDTVDYGDMKARRPPPQASSAGTPPEMD.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for WDR51A (3 products)

Catalog No. Species Pres. Purity   Source  


WDR51A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


WDR51A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


WDR51A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for WDR51A (3 products)

Catalog No. Species Pres. Purity   Source  

DKFZP434C245 293T Cell Transient Overexpression Lysate(Denatured)

DKFZP434C245 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

POC1A overexpression lysate

POC1A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

POC1A overexpression lysate

POC1A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn