NBP1-54844 WDR6 antibody

See related secondary antibodies

Search for all "WDR6"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse WDR6

Product Description for WDR6

Rabbit anti Human, Mouse WDR6.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for WDR6

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to WDR6 (WD repeat domain 6) The peptide sequence was selected from the C terminal of WDR6 . Peptide sequence TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE.
Background WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn