H00256764-B01P WDR72 antibody

See related secondary antibodies

Search for all "WDR72"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human WDR72

H00256764-B01P

Product Description for WDR72

Mouse anti Human WDR72.
Product is tested for Western blot / Immunoblot.

Properties for WDR72

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ38736, MGC126663, MGC126665
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3MJ13
Immunogen:
WDR72 (ACE87361.1, 1 a.a. ~ 1102 a.a) full-length human protein.
AA Sequence:
MRTSLQAVALWGQKAPPHSITAIMITDDQRTIVTGSQEGQPCLWNLSHELKISAKELLFGHSASVTCLARARDFSK QPYIVSAAENGEMCVWNVTNGQCVEKATLPYRHTAICYYHCSFRMTGEGWLLCCGEYQDVLIIDAKTLAVVHSFRS SQFPDWINCMCIVHSMRIQEDSLLVVSVAGGLKVWDLSSSINSIQEKQDVYEKESKFLESLNCQTIRFCTYTERLL LVVFSKCWKVYDYCDFSLLLTEVSRNGQFFAGGEVIAAHRILIWTEDGHSYIYQLLNSGLSKSIYPADGRVLKETI YLHLLCSTSVQENKEQSRPFVMGYMNERKEPFYKVLFSGEVSGRITLWHIPDVPVSKFDGSPREIPVTATWTLQDN FDKHDTMSQSIIDYFSGLKDGAGTAVVTSSEYIPSLDKLICGCEDGTIIITQALNAAKARLLEGGSLVKDSPPHKV LKGHHQSVTSLLYPHGLSSKLDQSWMLSGDLDSCVILWDIFTEEILHKFFLEAGPVTSLLMSPEKFKLRGEQIICC VCGDHSVALLHLEGKSCLLHARKHLFPVRMIKWHPVENFLIVGCADDSVYIWEIETGTLERHETGERARIILNCCD DPQLVKSVLPIASETLKHKSIEQRSSSPYQLGPLPCPGLQVESSCKVTDAKFCPRPFNVLPVKTKWSNVGFHILLF DLENLVELLLPTPLSDVDSSSSFYGGEVLRRAKSTVEKKTLTLRKSKTACGPLSAEALAKPITESLAQGDNTIKFS EENDGIKRQKKMKISKKMQPKPSRKVDASLTIDTAKLFLSCLLPWGVDKDLDYLCIKHLNILKLQGPISLGISLNE DNFSLMLPGWDLCNSGMIKDYSGVNLFSRKVLDLSDKYTATLPNQVGIPRGLENNCDSLRESDTIVYLLSRLFLVN KLVNMPLELACRVGSSFRMESIHNKMRGAGNDILNMSSFYSCLRNGKNESHVPEADLSLLKLISCWRDQSVQVTEA IQAVLLAEVQQHMKSLGKIPVNSQPVSMAENGNCEMKQMLPKLEWTEELELQCVRNTLPLQTPVSPVKHDSNSNSA NFQDVEDMPDRCALEESESPGEPRHHSWIAKVCPCKVS
GeneID:
256764
Add. information Mouse polyclonal antibody raised against a full-length human WDR72 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for WDR72 (2 products)

Catalog No. Species Pres. Purity   Source  

WDR72 Lysate

Western Blot: WDR72 Lysate [NBL1-17827] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for WDR72
0.1 mg / €400.00
  Novus Biologicals Inc.

WDR72 overexpression lysate

WDR72 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn