NBP1-93937 WDR78 antibody

See related secondary antibodies

Search for all "WDR78"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human WDR78

Product Description for WDR78

Rabbit anti Human WDR78.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for WDR78

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5VTH9
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: HLGPVWQLQWIEQDRGTTGDGKREILVSISADGRISKWVIRKGLDCYDLMRLKRTTAASNKKGGEKEKKDEALISRQAPGMCFAFHPK
GeneID:
79819
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 79819

Accessory Products

  • LinkedIn