discontinued

H00055135-M04 WDR79 / TCAB1 antibody

See related secondary antibodies

Search for all "WDR79 / TCAB1"

Quick Overview

Mouse anti Human WDR79 / TCAB1 1F12

Product Description for WDR79 / TCAB1

Mouse anti Human WDR79 / TCAB1 1F12.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for WDR79 / TCAB1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Telomerase Cajal body protein, WD repeat-containing protein 79, WD40 repeats-containing protein encoding RNA antisense to p53, WRAP53
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1F12
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BUR4
Immunogen:
WDR79 (NP_060551, 62 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPA AEDEGDTAWNYSFSQLPRFLSGS*
GeneID:
55135
Remarks:
Gene Accession: NM_018081
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant WDR79.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 55135

Accessory Products

Proteins and/or Positive Controls

Proteins for WDR79 / TCAB1 (8 products)

Catalog No. Species Pres. Purity   Source  

WDR79 / TCAB1 (transcript variant 1)

WDR79 / TCAB1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

WDR79 / TCAB1 (transcript variant 2)

WDR79 / TCAB1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

WDR79 / TCAB1 (transcript variant 3)

WDR79 / TCAB1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

WDR79 / TCAB1 (transcript variant 4)

WDR79 / TCAB1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

WDR79 / TCAB1

WDR79 / TCAB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

WDR79 / TCAB1

WDR79 / TCAB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

WDR79 / TCAB1

WDR79 / TCAB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

WDR79 / TCAB1

WDR79 / TCAB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for WDR79 / TCAB1 (6 products)

Catalog No. Species Pres. Purity   Source  

WDR79 293T Cell Transient Overexpression Lysate(Denatured)

WDR79 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

WDR79 Lysate

Western Blot: WDR79 Lysate [NBL1-17832] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for WRAP53
  Novus Biologicals Inc.

WRAP53 overexpression lysate

WRAP53 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

WRAP53 overexpression lysate

WRAP53 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

WRAP53 overexpression lysate

WRAP53 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

WRAP53 overexpression lysate

WRAP53 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn