
NBP1-54801 WDR9 antibody

See related secondary antibodies

Search for all "WDR9"

Quick Overview

Rabbit anti Human WDR9

Product Description for WDR9

Rabbit anti Human WDR9.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for WDR9

Product Category Primary Antibodies
Quantity 50 µg
Synonyms C21orf107, FLJ43918, N143, WDR9
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to BRWD1(bromodomain and WD repeat domain containing 1) The peptide sequence was selected from the N terminal of BRWD1. Peptide sequence MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK.
Background This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 54014

Accessory Products

  • LinkedIn