
NBP1-56587 WDTC1 antibody

See related secondary antibodies

Search for all "WDTC1"

Quick Overview

Rabbit anti Human, Mouse, Rat WDTC1

Product Description for WDTC1

Rabbit anti Human, Mouse, Rat WDTC1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for WDTC1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ADP, KIAA1037
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to WDTC1(WD and tetratricopeptide repeats 1) The peptide sequence was selected from the N terminal of WDTC1. Peptide sequence PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVN.
Background WDTC1 contains 2 TPR repeats and 7 WD repeats. WDTC1, the ortholog of Drosophila Adipose Gene, associates with human obesity, modulated by MUFA intake.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 23038

Accessory Products

  • LinkedIn