NBP1-93436 WFDC10B antibody

See related secondary antibodies

Search for all "WFDC10B"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human WFDC10B

Product Description for WFDC10B

Rabbit anti Human WFDC10B.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for WFDC10B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RDKMRMQRIKVCEKRPSIDLCIHHCSYFQKCETNKICCSAFCGNICMSIL
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
Aff - Purified
Gene ID 280664

Accessory Products

Proteins and/or Positive Controls

Positive controls for WFDC10B (1 products)

Catalog No. Species Pres. Purity   Source  

WFDC10B overexpression lysate

WFDC10B overexpression lysate
  OriGene Technologies, Inc.
  • LinkedIn