TA344944 WIPI-1 antibody

Rabbit Polyclonal Anti-WIPI1 Antibody - middle region

See related secondary antibodies

Search for all "WIPI-1"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat WIPI-1

TA344944

More Views

  • TA344944
  • TA344944

Product Description for WIPI-1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat WIPI-1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WIPI-1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Atg18 protein homolog, WD repeat domain phosphoinositide-interacting protein 1, WD40 repeat protein interacting with phosphoinositides of 49 kDa, WIPI1, WIPI49
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5MNZ9
Immunogen:
The immunogen for anti-WIPI1 antibody: synthetic peptide directed towards the middle region of human WIPI1. Synthetic peptide located within the following region: LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRG.
GeneID:
55062
Application WB
Background WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI su
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for WIPI-1 (4 products)

Catalog No. Species Pres. Purity   Source  

WIPI-1

WIPI-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

WIPI-1

WIPI-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

WIPI-1

WIPI-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

WIPI-1

WIPI-1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

Positive controls for WIPI-1 (2 products)

Catalog No. Species Pres. Purity   Source  

WIPI1 Lysate

Western Blot: WIPI1 Lysate [NBL1-17853] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for WIPI1
  Novus Biologicals Inc.

WIPI1 overexpression lysate

WIPI1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn