TA344069 WNT2B antibody

Rabbit Polyclonal Anti-WNT2B Antibody

See related secondary antibodies

Search for all "WNT2B"

0.1 mg / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat WNT2B


More Views

  • TA344069
  • TA344069

Product Description for WNT2B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat WNT2B.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for WNT2B

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Protein Wnt-2b, WNT13, Wnt-13
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT.
Application WB
Background WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted sigling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis. This gene produces two altertive transcript variants.This gene encodes a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted sigling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis. This gene produces two altertive transcript variants.
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn