discontinued

H00089780-D01 WNT3A antibody

See related secondary antibodies

Search for all "WNT3A"

Quick Overview

Rabbit anti Human WNT3A

Product Description for WNT3A

Rabbit anti Human WNT3A.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation.

Properties for WNT3A

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Protein Wnt-3a
Presentation Serum
Reactivity Hu
Applications E(detection), IP
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P56704
Immunogen:
WNT3A (AAI03922.1, 1 a.a. ~ 385 a.a) full-length human protein.
AA Sequence:
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQE CQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKW GGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIG DFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGI DGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCKNPGSRAGNSAHQPPHPQPPVRFHPPLRR AGKVP
GeneID:
89780
Remarks:
Gene Accession: BC103921
Add. information Rabbit polyclonal antibody raised against a full-length human WNT3A protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IP
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 89780

Accessory Products

Proteins and/or Positive Controls

Proteins for WNT3A (5 products)

Catalog No. Species Pres. Purity   Source  

WNT3A (19-352, )

WNT3A Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

WNT3A (19-352, )

WNT3A Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

WNT3A

WNT3A Human Purified
  Abnova Taiwan Corp.

WNT3A

WNT3A Human Purified
  Abnova Taiwan Corp.

WNT3A

WNT3A Human Purified
  Abnova Taiwan Corp.

Positive controls for WNT3A (3 products)

Catalog No. Species Pres. Purity   Source  

WNT3A 293T Cell Transient Overexpression Lysate(Denatured)

WNT3A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Wnt3a Lysate

Western Blot: Wnt3a Lysate [NBL1-17870] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for WNT3A
  Novus Biologicals Inc.

WNT3A overexpression lysate

WNT3A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn