discontinued

H00009589-B01 WT1 / Wilms tumor protein antibody

See related secondary antibodies

Search for all "WT1 / Wilms tumor protein"

Quick Overview

Mouse anti Human WT1 / Wilms tumor protein

H00009589-B01

More Views

  • H00009589-B01

Product Description for WT1 / Wilms tumor protein

Mouse anti Human WT1 / Wilms tumor protein.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for WT1 / Wilms tumor protein

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms WT33
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P19544
Immunogen:
WTAP (NP_004897.2, 1 a.a. ~ 396 a.a) full-length human protein.
AA Sequence:
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENIL VMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDSQ TGKKLMAKCRMLIQENQELGRQLSQGRIAQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILVLQQQ LKETRQQLAQYQQQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNGSSSRQRTSGSGFHREGNTTEDDFP SSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLTHQSNDTDSSHDPQEEKAVSGKGNRTVGSRH VQNGLDSSVNVQGSVL
GeneID:
7490
Remarks:
Gene Accession: NM_004906.3
Add. information Mouse polyclonal antibody raised against a full-length human WTAP protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 9589

Accessory Products

Proteins and/or Positive Controls

Proteins for WT1 / Wilms tumor protein (7 products)

Catalog No. Species Pres. Purity   Source  

WT1 / Wilms tumor protein (full length, N-term HIS tag, transcript variant B)

WT1 / Wilms tumor protein Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

WT1 / Wilms tumor protein (full length, N-term HIS tag, transcript variant A)

WT1 / Wilms tumor protein Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for WT1 / Wilms tumor protein (1 products)

Catalog No. Species Pres. Purity   Source  

Wilms Tumor 1 Lysate

Western Blot: Wilms Tumor 1 Lysate [NBL1-17887] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for WT1
  Novus Biologicals Inc.
  • LinkedIn